Protein Info for CCNA_01515 in Caulobacter crescentus NA1000 Δfur

Annotation: C4-dicarboxylate transporter large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 43 to 67 (25 residues), see Phobius details amino acids 93 to 122 (30 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 155 to 160 (6 residues), see Phobius details amino acids 171 to 195 (25 residues), see Phobius details amino acids 207 to 235 (29 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 359 to 386 (28 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details PF06808: DctM" amino acids 7 to 417 (411 residues), 389.1 bits, see alignment E=1.2e-120 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 422 (406 residues), 431 bits, see alignment E=2e-133

Best Hits

Swiss-Prot: 44% identical to YGIK_SALTY: Uncharacterized protein YgiK (ygiK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01515)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6T8 at UniProt or InterPro

Protein Sequence (426 amino acids)

>CCNA_01515 C4-dicarboxylate transporter large subunit (Caulobacter crescentus NA1000 Δfur)
MELTLLLGLLALLLIIGVPVAFALGLASLVTFIFMDIAPVVAFQRIATGVNVFSLMAIPF
FIFAGDLMQQAGIAERLVRVADAAMGRIRGGLGVVDVGASMMFGGVSGSAVASVSALGST
LIPLMKEKGYDADYAVNVTSTSAILGILIPPSHNMIIYAAAAGVSVSVADLFLAGVLPGI
LTGIFLAAAAWIIAVRRGYPKGEFPGWPAFAAAFASALPGLLTAVIIFGGVLGGVFTPTE
SSAVAVIYTLVIAVIVYRTLGFRGFTTAAQNAVKTTAMVMLIIGSAAAFGWLLALLEAPE
QLATLLQTLTDNPILILLLINLILLILGTFMDMAPLIVITSPIFLPVAMATGMDPVQFGI
MMMLNLGIGLVTPPVGSVLFVGCAVGKIKVEQAVRTIWPFYLALFAALMAITFVPALTLT
LPGLAG