Protein Info for CCNA_01477 in Caulobacter crescentus NA1000 Δfur

Annotation: oxygen-independent coproporphyrinogen-III oxidase hemN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 406 to 421 (16 residues), see Phobius details TIGR00538: oxygen-independent coproporphyrinogen III oxidase" amino acids 16 to 444 (429 residues), 365.1 bits, see alignment E=2.8e-113 PF04055: Radical_SAM" amino acids 55 to 226 (172 residues), 93.8 bits, see alignment E=7.2e-31

Best Hits

Swiss-Prot: 46% identical to HEMN_BRADU: Oxygen-independent coproporphyrinogen III oxidase (hemN) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 100% identity to ccr:CC_1411)

Predicted SEED Role

"Coproporphyrinogen III oxidase, oxygen-independent (EC 1.3.99.22)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.99.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9G8 at UniProt or InterPro

Protein Sequence (454 amino acids)

>CCNA_01477 oxygen-independent coproporphyrinogen-III oxidase hemN (Caulobacter crescentus NA1000 Δfur)
MMTQTVLSSVQRAHAERNLPRYTSYPTAVAFDAAQVTQAPDWFAKTRSEDHLSVYVHVPF
CRRLCWYCGCHTSIAHTYERVGTYADVLAREIDLTARRLGEHDGLAHLHFGGGSPNALSP
SDFKRLVAQLKTAFRVRPGAEIAAELDPGMLSDTFVDATGEAGVTRVSLGVQTFDPTVQA
LVNRVQPFEQVAAAVERLRAVGVGGLNFDLMYGLPGQTVENVYASAKTAVALRPDRIAVF
GYAHVPWMKKHQTMIQETDLADIDGRWAQADAADAALTEAGYVRIGLDHYALPDDSLSRA
AAEGRLRRNFQGYTDDPAPVLVPIGPSSIGQFREGFVQNLTPTDAWAARIARDELPLGRA
LAFSDEDRLRAAVIERLMCDMTVDVAAICEAHGFSTDHLAGSLASLAAIEVAGLCVLDGA
VVTIPEDARRLMRVVAAAFDDRLPATVTRHAKAV