Protein Info for CCNA_01447 in Caulobacter crescentus NA1000 Δfur

Annotation: homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 12 to 130 (119 residues), 50.8 bits, E=3.9e-17
• PF00742: Homoserine_dh
  • amino acids 138 to 315 (178 residues), 203 bits, E=4.8e-64
• PF01842: ACT
  • amino acids 350 to 412 (63 residues), 40.7 bits, E=2.3e-14

Best Hits

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 100% identity to ccr:CC_1383)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

See A0A0H3C7Y3 at UniProt or InterPro

Protein Sequence (429 amino acids)

>CCNA_01447 homoserine dehydrogenase (Caulobacter crescentus NA1000 Δfur)
MTNKTWRVGVAGLGTVGGGLLQFLAERPGFAPAGDLAVVTAVSARSKSRPRTVDISNLVW
FDDPVALAASPEIDIFVELVGGSDGPAKAAVETALKAGKPVVTANKALIAEHGAELAALA
EATNTPLLFEAAVMGGVPAVKMMREALVGDDIISVAGILNGTCNFILSEMEKTGRSFADV
LREAQGLGYAEADPTMDVGGFDAGHKVSILAALAFGCAPNFAAAEIEGISEVDLLDIKLA
KDLGYRIKLIAGAAKSEDGVAVKVHPSLVPLDHPLAQAGGALNALFIEGKRIGRIFLQGP
GAGAGPTAAAVAADIADVMTKAVRPVFQAPAGDLKPFVSIDPSKAVGKAYLRVMVQDQPG
VIAAISETLAECGVSIDSFLQKPVEGAGGVPIVLVTHATPESNLLDAISRIEKLQTVLER
PRLLRVARI