Protein Info for CCNA_01431 in Caulobacter crescentus NA1000 Δfur

Annotation: fatty acid/phospholipid synthesis protein plsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02504: FA_synthesis
  • amino acids 6 to 325 (320 residues), 369 bits, E=2.1e-114
• TIGR00182: fatty acid/phospholipid synthesis protein PlsX
  • amino acids 7 to 337 (331 residues), 321.6 bits, E=3.1e-100

Best Hits

Swiss-Prot: 100% identical to PLSX_CAUVC: Phosphate acyltransferase (plsX) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 100% identity to ccr:CC_1368)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• phosphatidylglycerol biosynthesis I (5/6 steps found)
• phosphatidylglycerol biosynthesis II (5/6 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (7/12 steps found)
• palmitoyl ethanolamide biosynthesis (2/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• diacylglycerol and triacylglycerol biosynthesis (2/7 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis II (2/8 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (5/13 steps found)
• anandamide biosynthesis I (3/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (7/28 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

See A0A0H3C7B8 at UniProt or InterPro

Protein Sequence (360 amino acids)

>CCNA_01431 fatty acid/phospholipid synthesis protein plsX (Caulobacter crescentus NA1000 Δfur)
MSQSLVISVDAMGGDHGPSIVVPGIAQALQALPGVRFLLHGDGAAIEAELAKHPGAKAVS
EVRHCDKAIGMDEKPAQAMRRGKGSSMWNAVEAVRENEAQACVSAGNTGALMAISKLILR
MGAELERPAIVANWPTMKGVTTVLDVGANVESDASQLVEFAIMGAAFHHAVHGSKRPTVG
LLNVGSEDQKGHEEVREAHAILRETTLDFDYHGFVEGNDIAYGTVDVVVTDGFTGNVALK
TAEGLARFFSNEIKSTLTSGPLAMLGALIASGALKKMRHRLDPSRVNGAPLLGLNGIVVK
SHGGADANGFASAIRVATNLARSDFRAEIDRNLKRLTATAAAIKSGDGQGPGEDAQGVAE