Protein Info for CCNA_01367 in Caulobacter crescentus NA1000 Δfur

Annotation: nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02277: DBI_PRT
  • amino acids 32 to 294 (263 residues), 158.7 bits, E=1.1e-50

Best Hits

Swiss-Prot: 49% identical to COBT_AGRFC: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (cobT) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00768, nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC: 2.4.2.21] (inferred from 100% identity to ccs:CCNA_01367)

Predicted SEED Role

"Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.4.2.21)

MetaCyc Pathways

• 2-methyladeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (1/3 steps found)
• 5-hydroxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (1/3 steps found)
• 5-methoxy-6-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (1/3 steps found)
• 5-methoxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (1/3 steps found)
• 5-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (1/3 steps found)
• adeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (1/3 steps found)
• adenosylcobalamin biosynthesis from adenosylcobinamide-GDP I (1/3 steps found)
• benzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (1/3 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide I (4/8 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (4/9 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (15/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (14/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.21

Sequence Analysis Tools

See A0A0H3C745 at UniProt or InterPro

Protein Sequence (296 amino acids)

>CCNA_01367 nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (Caulobacter crescentus NA1000 Δfur)
MTDQTVSPFADIRQLASSPPQPGPTPALEQGGRLAEIAAWLTAWTGKTPPAVNRPVVALY
AGARQGVGPRGWARERLEAIAAGGATVSRLAGVQGAGLEAFDLAIDRPSPDMVSKASMSE
KEAAATMAFGMEALAKQPDLLIPGVIAAEPARTAAAVCLALFGGEASDWSSDPEPVAAAV
ARAREEGMGDDPLEILRQLGGRETAAVAGAILAARVQKTPVLLDGYAACAAAAIVQAVEP
TAIDHCLAAHVSPARGHAKLLEKLGKQPLLSLGAEDEEGVGGVSALALVKLACEAR