Protein Info for CCNA_01365 in Caulobacter crescentus NA1000 Δfur

Annotation: aspartyl protease perP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02281: clan AA aspartic protease, TIGR02281 family" amino acids 54 to 171 (118 residues), 152.1 bits, see alignment E=3.7e-49 PF13975: gag-asp_proteas" amino acids 67 to 157 (91 residues), 93.7 bits, see alignment E=8.7e-31 PF13650: Asp_protease_2" amino acids 67 to 154 (88 residues), 84.3 bits, see alignment E=8e-28

Best Hits

KEGG orthology group: K06985, aspartyl protease family protein (inferred from 100% identity to ccs:CCNA_01365)

Predicted SEED Role

"CblY, a non-orthologous displasment for Alpha-ribazole-5'-phosphate phosphatase" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C966 at UniProt or InterPro

Protein Sequence (172 amino acids)

>CCNA_01365 aspartyl protease perP (Caulobacter crescentus NA1000 Δfur)
MSSMLRFAAIALVGALSAVGAAKAVVSLDDLRHPELRAPSAATATLGGAEGGAAQLSKDS
DGHFWAQGNVDGKAVRFLVDTGATAVSLSLADAQRLGIDTSRLTYDYNVITADGRTRAAA
VKLASVSIAGARVRDVDALVIEKGLENSLLGMSYLGRLSRFEATQTSLILHP