Protein Info for CCNA_01326 in Caulobacter crescentus NA1000 Δfur

Annotation: protein translocase subunit secY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details amino acids 375 to 399 (25 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details TIGR00967: preprotein translocase, SecY subunit" amino acids 25 to 435 (411 residues), 406.9 bits, see alignment E=4.8e-126 PF00344: SecY" amino acids 81 to 424 (344 residues), 364 bits, see alignment E=3.5e-113

Best Hits

Swiss-Prot: 51% identical to SECY_PSEAE: Protein translocase subunit SecY (secY) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03076, preprotein translocase subunit SecY (inferred from 100% identity to ccs:CCNA_01326)

Predicted SEED Role

"Preprotein translocase secY subunit (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C710 at UniProt or InterPro

Protein Sequence (451 amino acids)

>CCNA_01326 protein translocase subunit secY (Caulobacter crescentus NA1000 Δfur)
MASAAEQLAANMNFASFQKATELHKRIWFTIIALIVYRLGTYVPIPGVDPTAFASLFSQN
SKGLLGMFDMFSGGAVERMAIFSLNVMPYISASIIVQLMGTVYPPWEKLKKEGGEAGRKT
LNQYTRYLAVILAVVQSASIAIGIAAQPGVVADGVGHTFFIVSTIVALTGGTMFLMWLGE
QITSRGVGNGVSLIIFAGIVASLPIKLMQMLTQAQSNNNYLPLFLVVFGGIAAILAIVFI
ERSQRRLLVHYPKRQQGNRMIGGESSFMPLKINTAGVIPPIFASSLLLLPTTALQLVQTA
NLPGWASWLPAMVGALQHGQPAFLALYALLIIFFSFFYTSVVFNPDETAENLRKYGGFLP
GIRPGKRTAEYLDYVLTRLTVIGAAYITAVCIAPEFVMMAMNSTQFALGGTSILIVVTVT
MDTVAQIQSHLLAHQYEGLIKKSKLRGGRGR