Protein Info for CCNA_01322 in Caulobacter crescentus NA1000 Δfur

Annotation: LSU ribosomal protein L18P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 PF00861: Ribosomal_L18p" amino acids 7 to 116 (110 residues), 140.7 bits, see alignment E=1.3e-45 TIGR00060: ribosomal protein uL18" amino acids 9 to 116 (108 residues), 139.3 bits, see alignment E=3.5e-45

Best Hits

Swiss-Prot: 100% identical to RL18_CAUVN: 50S ribosomal protein L18 (rplR) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K02881, large subunit ribosomal protein L18 (inferred from 99% identity to cse:Cseg_1507)

Predicted SEED Role

"LSU ribosomal protein L18p (L5e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H4F0 at UniProt or InterPro

Protein Sequence (116 amino acids)

>CCNA_01322 LSU ribosomal protein L18P (Caulobacter crescentus NA1000 Δfur)
MALSPRESAAKRAQRVRTRLKSLANGRPRLSVFRSSKNIYAQVIDDERGVTLASASTLEA
EGKGADKDAAAAVGKLVAERAIEKGVKDVVFDRGSYIFHGRVKALADAAREAGLNF