Protein Info for CCNA_01258 in Caulobacter crescentus NA1000 Δfur

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 54 to 74 (21 residues), see Phobius details amino acids 95 to 109 (15 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details PF06149: DUF969" amino acids 1 to 212 (212 residues), 295.2 bits, see alignment E=1.4e-92

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01258)

Predicted SEED Role

"FIG015373: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7P5 at UniProt or InterPro

Protein Sequence (220 amino acids)

>CCNA_01258 hypothetical protein (Caulobacter crescentus NA1000 Δfur)
MLTLLGVAVIVLGFALRFNPLLVVVAAAMTSGLAAGLAPLEVLAAFGKAFNTNRYVSVAW
LILPAIGVLERAGLREQARRTIQELRAATAGRILLAYLALRQVAAALGLTQVAGHAQTVR
PLLAPMAEAAAEPLSDDQRQKVRAMSAATDNIGLFFGEDIFLAIGSILLIVGFLDQSGIT
VEPLALSVWAIPTAIAAFLIHGARLLMFDRHLTPKAEDAA