Protein Info for CCNA_01179 in Caulobacter crescentus NA1000 Δfur

Annotation: 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to CYSH_RHILO: Phosphoadenosine phosphosulfate reductase (cysH) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 100% identity to ccs:CCNA_01179)

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) / Adenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.10)" in subsystem Cysteine Biosynthesis (EC 1.8.4.10, EC 1.8.4.8)

MetaCyc Pathways

superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
assimilatory sulfate reduction I (4/4 steps found)
assimilatory sulfate reduction III (3/3 steps found)
assimilatory sulfate reduction IV (3/4 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.10 or 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7B1 at UniProt or InterPro

Protein Sequence (244 amino acids)

>CCNA_01179 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (Caulobacter crescentus NA1000 Δfur)
MAYDQTSATAPGLAARLDAELRDAHPSEILRTAHEHFGDKLALVSSFGAESAVLLHLASR
VSPGLPVLFLDTGMLFGQTLDYRKNIAAQFGLTDVRDLRPAFADLATQDPNSDLWRTSVD
GCCHIRKVLPLDRALGGFDAWITGRKRFHGGDRLSLPVVEEADGKIKFNPLANWSKAELD
AYVAEHDLPAHPLVAQGYASVGCWPCTQPSDDGRSGRWAGQEKTECGIHVARAPGVAPNV
GGDI