Protein Info for CCNA_01145 in Caulobacter crescentus NA1000 Δfur

Annotation: monoamine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01134: GIDA
  • amino acids 60 to 87 (28 residues), 20.5 bits, see alignment (E = 6.9e-08)
• PF00890: FAD_binding_2
  • amino acids 61 to 98 (38 residues), 27.7 bits, 5e-10
• PF13450: NAD_binding_8
  • amino acids 63 to 102 (40 residues), 43.6 bits, 8.7e-15
• PF01593: Amino_oxidase
  • amino acids 68 to 522 (455 residues), 182.4 bits, E=6.2e-57

Best Hits

KEGG orthology group: K00274, monoamine oxidase [EC: 1.4.3.4] (inferred from 100% identity to ccs:CCNA_01145)

Predicted SEED Role

"Tryptophan 2-monooxygenase (EC 1.13.12.3)" in subsystem Aromatic amino acid degradation (EC 1.13.12.3)

MetaCyc Pathways

• indole-3-acetate biosynthesis III (bacteria) (2/2 steps found)
• phenylethylamine degradation I (1/2 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• putrescine degradation III (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• serotonin degradation (4/7 steps found)
• L-tryptophan degradation VI (via tryptamine) (1/3 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• dopamine degradation (2/5 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• melatonin degradation II (1/4 steps found)
• aromatic biogenic amine degradation (bacteria) (3/8 steps found)
• superpathway of phenylethylamine degradation (5/11 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• superpathway of melatonin degradation (1/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Arginine and proline metabolism
• Biosynthesis of plant hormones
• Drug metabolism - cytochrome P450
• Glycine, serine and threonine metabolism
• Histidine metabolism
• Phenylalanine metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.13.12.3, 1.4.3.4

Use Curated BLAST to search for 1.13.12.3 or 1.4.3.4

Sequence Analysis Tools

See A0A0H3C6K8 at UniProt or InterPro

Protein Sequence (534 amino acids)

>CCNA_01145 monoamine oxidase (Caulobacter crescentus NA1000 Δfur)
MSGSDASPAASVLTRRRFFESLAAVGGMSLVLSGMEALGFSQASATELPPTLTGGAKNTK
VIILGAGLAGMTAAYEMSKAGYQVQILEARDYAGGRCQTARKGFKHTDLLGNTQVCEFDD
GHYINHGAWRIPYHHRSTLHYTKSFGVLLESFVNDNDASYVYFEKGKGPLNGKPVRKGEI
AADVRGYTAELVAKAASAGALDAPLSGVDRERFVAYLVNEGRLSKSDLTYKGTEGRGFSV
HPGAGVNPGPGKELEPFAFKDVLDSNAWRVLSSVTGYEQQRTMLQPIGGMDQIAKAFEKR
VAPMIRYSTVVQKIKQSPTGVTVSFKGPDGKLGEVTADYCVCTIPLSVLKQIDLDASAPF
KAAMEGVAYAPVNKIGLQMKSRFWEDRHHIYGGHIYTDLAGIGSISLPSYGWQAQKGVLL
GYYAFGGEAARISAKSPADRAAFAVAGGQKVFPEYAENFENAFSFSWHLAEHNLGGWAEW
GENGRKEAYPILCEPDGRLYLAGEHLSYLGGWQAGAIESAWQQIAKIHARVQQA