Protein Info for CCNA_01141 in Caulobacter crescentus NA1000 Δfur

Annotation: RecA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR02012: protein RecA" amino acids 16 to 335 (320 residues), 584.9 bits, see alignment E=2.3e-180 PF00154: RecA" amino acids 19 to 280 (262 residues), 483 bits, see alignment E=4.5e-149 PF08423: Rad51" amino acids 47 to 239 (193 residues), 37.9 bits, see alignment E=2.4e-13 PF21096: RecA_C" amino acids 283 to 337 (55 residues), 88.9 bits, see alignment 3.8e-29

Best Hits

Swiss-Prot: 100% identical to RECA_CAUVN: Protein RecA (recA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to ccs:CCNA_01141)

MetaCyc: 67% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H3I7 at UniProt or InterPro

Protein Sequence (356 amino acids)

>CCNA_01141 RecA protein (Caulobacter crescentus NA1000 Δfur)
MTSQAALKLVAKEEGDKQRALEAALAQIDRAFGKGSVMKLGEKGKVEIESVSTGSLGLDI
ALGIGGLPKGRIVEVYGPESSGKTTLALHVVAEVQKAGGTAAFVDAEHALDPSYAYKLGV
NLDNLLVSQPDNGEQALEITDTLVRSGAVDIVVVDSVAALTPKAEIEGEMGDSLPGLQAR
LMSQALRKLTASINKANTIVIFINQIRHKIGVMYGSPETTTGGNALKFYASVRLDIRRTG
SVKARDEIVGNNVRVKVVKNKVAPPFREVEFDIMYGEGISKLGEVIDLGVKAGIIDKAGS
WFSYGSQRIGQGRDNVREFLKNNPDVAADIEKAVRKSSQKIEEELLVGGPEEGEED