Protein Info for CCNA_01114 in Caulobacter crescentus NA1000 Δfur

Annotation: cysteine desulfurase subunit SufE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF02657: SufE" amino acids 14 to 134 (121 residues), 153.2 bits, see alignment E=1.3e-49

Best Hits

Swiss-Prot: 56% identical to Y1250_RHIEC: Uncharacterized SufE-like protein RHE_CH01250 (RHE_CH01250) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K02426, cysteine desulfuration protein SufE (inferred from 100% identity to ccs:CCNA_01114)

MetaCyc: 43% identical to sulfur carrier protein SufE (Escherichia coli K-12 substr. MG1655)
RXN0-7443

Predicted SEED Role

"Sulfur acceptor protein SufE for iron-sulfur cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7C1 at UniProt or InterPro

Protein Sequence (141 amino acids)

>CCNA_01114 cysteine desulfurase subunit SufE (Caulobacter crescentus NA1000 Δfur)
MTSPIDTALTDLADEFELLGDWEERYRYVIELGKDLAPLTDAERSEANKVRGCASQVWLV
TEPQADGSIVFRGDSDAHIVSGLIAILLRLYSGRAAADIAGFDAKAAFDRLGLSEALSSQ
RSNGLKSMVARIQRDAQAALG