Protein Info for CCNA_01101 in Caulobacter crescentus NA1000 Δfur

Annotation: translation initiation factor 3 (IF-3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF05198: IF3_N" amino acids 12 to 81 (70 residues), 105.9 bits, see alignment E=9.5e-35 TIGR00168: translation initiation factor IF-3" amino acids 12 to 173 (162 residues), 215.5 bits, see alignment E=1.8e-68 PF00707: IF3_C" amino acids 88 to 172 (85 residues), 132.3 bits, see alignment E=4.9e-43

Best Hits

Swiss-Prot: 100% identical to IF3_CAUVC: Translation initiation factor IF-3 (infC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 100% identity to ccr:CC_1049)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H312 at UniProt or InterPro

Protein Sequence (173 amino acids)

>CCNA_01101 translation initiation factor 3 (IF-3) (Caulobacter crescentus NA1000 Δfur)
MQTPPVKDGPRINDEIRVPRVLLIDQHGEKQGEMPTASAMEAAEEAGLDLVEIVPNANPP
VCKILDYGKFKFQEQKKKNEARKRQKVVELKEIKLRPNIDSHDYDVKAKAMHRFFEEGDK
VKVTLRFRGREMAHPELGMKLLQKVKADFDEVAKVEYEPRMEGRQMIMILAPR