Protein Info for CCNA_01006 in Caulobacter crescentus NA1000 Δfur

Annotation: flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 TIGR00205: flagellar hook-basal body complex protein FliE" amino acids 29 to 102 (74 residues), 49.5 bits, see alignment E=2.6e-17 PF02049: FliE" amino acids 29 to 103 (75 residues), 74.6 bits, see alignment E=2.9e-25

Best Hits

Swiss-Prot: 100% identical to FLIE_CAUVC: Flagellar hook-basal body complex protein FliE (fliE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 100% identity to ccs:CCNA_01006)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8E1 at UniProt or InterPro

Protein Sequence (103 amino acids)

>CCNA_01006 flagellar hook-basal body complex protein FliE (Caulobacter crescentus NA1000 Δfur)
MITALAAAKAYANSGAMSVGSIGSIGGSQDKGVDFGDLLKSAMDGATKASKVAEHKIAAQ
VAGKAELVDVVTAISSAEASLETVMSIRDQVISAYQEIMRMPI