Protein Info for CCNA_01002 in Caulobacter crescentus NA1000 Δfur

Annotation: flagellar biosyntheis protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 62 to 91 (30 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details PF00813: FliP" amino acids 64 to 256 (193 residues), 267.6 bits, see alignment E=3.6e-84 TIGR01103: flagellar biosynthetic protein FliP" amino acids 64 to 260 (197 residues), 304.6 bits, see alignment E=1.5e-95

Best Hits

Swiss-Prot: 100% identical to FLIP_CAUVC: Flagellar biosynthetic protein FliP (fliP) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 100% identity to ccr:CC_0951)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C588 at UniProt or InterPro

Protein Sequence (266 amino acids)

>CCNA_01002 flagellar biosyntheis protein FliP (Caulobacter crescentus NA1000 Δfur)
MIRDLFKSVIGAKAEDLRRAAIISVLAAIACAIMPAAAMAQSAVNINLGTGAGLTERVVQ
LVGLMTVLSLAPSIVIMTTSFVRIVVVLGLLRTAIGVQQSPPNPVLISLALFLTAIVMAP
TFERSYDAGIKPLLDQQMELPEAFEAASGPVKQFMLSQVDRDDLALFVRLSKIPQPRTAA
ETPLRVVTPAFMISELKRAFEIGFLLFIPFLVIDLVVASVLMSMGMMMLPPASISLPFKL
IFFVLVDGWRLVAGSLVESFQRGAGG