Protein Info for CCNA_00981 in Caulobacter crescentus NA1000 Δfur

Annotation: ABC-type transport system involved in lipoprotein release, ATPase component LolD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00005: ABC_tran" amino acids 24 to 173 (150 residues), 125.3 bits, see alignment E=2.9e-40

Best Hits

Swiss-Prot: 100% identical to LOLD1_CAUVC: Lipoprotein-releasing system ATP-binding protein LolD 1 (lolD1) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to ccr:CC_0932)

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8B8 at UniProt or InterPro

Protein Sequence (234 amino acids)

>CCNA_00981 ABC-type transport system involved in lipoprotein release, ATPase component LolD (Caulobacter crescentus NA1000 Δfur)
MTNVIEARGIEKVFHNGDEETRVLKGIDLTLGQGELAAMVGASGSGKSTLLSIIGLLLRP
TAGTLSISGERVDDLSERMRARFRNQRLGFVFQFHHLLPDFTAMENVAFPAAAPGGGISR
AMRTRARDLLARVGLEDRIDFPAARLSGGQKQRVAIARALMNRPDLIIADEPTGNLDRES
ADRVLDLMREVNREEGATFLICTHDDGVAARCGRRLTLSDGRLTSNVRDPGGFS