Protein Info for CCNA_00941 in Caulobacter crescentus NA1000 Δfur

Annotation: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 36 to 395 (360 residues), 304.3 bits, see alignment E=4.9e-95 PF03054: tRNA_Me_trans" amino acids 36 to 236 (201 residues), 237.9 bits, see alignment E=1.3e-74 PF20259: tRNA_Me_trans_M" amino acids 252 to 305 (54 residues), 65.6 bits, see alignment 3.6e-22 PF20258: tRNA_Me_trans_C" amino acids 314 to 395 (82 residues), 51.5 bits, see alignment E=1.6e-17

Best Hits

Swiss-Prot: 100% identical to MNMA_CAUVC: tRNA-specific 2-thiouridylase MnmA (mnmA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 100% identity to ccs:CCNA_00941)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6U5 at UniProt or InterPro

Protein Sequence (407 amino acids)

>CCNA_00941 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase MnmA (Caulobacter crescentus NA1000 Δfur)
MDLALTDTTSALDSDTLIARAVEQVRAAVGLPEGARIVAAMSGGVDSTVTAALLARAGYD
VVGVTLQLYDHGAAISRKGACCAGQDILDARMAAERIGIPHYVLDYESRFREQVIEDFAD
AYLRGETPIPCVRCNQTVKFRDLLDVARDLGAEAMATGHYVQRAMPGNGGNRPELRRAAD
PAKDQSYFLFATTREQLDFLRFPLGGMDKPTVRAVAAGLGLSIADKPDSQDICFVPEGKY
TTVIDRIRPQGAEAGDVVHLDGRVLGRHEGVTRYTIGQRRGLNIAVGDPLFVVKINADKR
QVIVGPREALLTASLTLKEGSWLGAQDSLEAAAEDGQRVLARVRSTREPVPGRLAMIDGA
LSVVFDGAEEGVAPGQACVLYDPADPDRVLGGGFIAGTTRQMDLNAA