Protein Info for CCNA_00918 in Caulobacter crescentus NA1000 Δfur

Annotation: peptide release factor-glutamine N5-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF17827: PrmC_N" amino acids 8 to 77 (70 residues), 72.2 bits, see alignment E=2.2e-23 TIGR00536: methyltransferase, HemK family" amino acids 10 to 283 (274 residues), 208.2 bits, see alignment E=1.4e-65 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 27 to 278 (252 residues), 282.6 bits, see alignment E=2.8e-88 PF03602: Cons_hypoth95" amino acids 94 to 198 (105 residues), 25.4 bits, see alignment E=5.4e-09 PF05175: MTS" amino acids 107 to 192 (86 residues), 47.6 bits, see alignment E=7.4e-16 PF06325: PrmA" amino acids 117 to 204 (88 residues), 25.4 bits, see alignment E=4.8e-09 PF13847: Methyltransf_31" amino acids 117 to 246 (130 residues), 54.1 bits, see alignment E=8e-18 PF13649: Methyltransf_25" amino acids 119 to 189 (71 residues), 37.6 bits, see alignment E=1.5e-12 PF08241: Methyltransf_11" amino acids 119 to 189 (71 residues), 28.3 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 100% identical to PRMC_CAUVC: Release factor glutamine methyltransferase (prmC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to ccs:CCNA_00918)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4X9 at UniProt or InterPro

Protein Sequence (289 amino acids)

>CCNA_00918 peptide release factor-glutamine N5-methyltransferase (Caulobacter crescentus NA1000 Δfur)
MTLTLVKAWTAAKDRLKDAGIDQPSIDARLMLEVAAGVTRTEIVTDPYRELSAEQIATLN
DYLERRARREPVSHIIGRKGFWKILLQVNKNVLTPRPETEVIVDEVLKAFPEHMAFSMLD
LGVGSGTILLAVLAERPAAKGLGIDASSEALAVARENAANLDLNTRAALLHGDWTTGLGS
DSFDLVVSNPPYIPTEVIDTLEPEVRIHEPRLALDGGPDGLAAYRELAPEILRVLKPGGL
FAVEIGYDQSQAVEALFRAAGATEVRTVKDLSTHDRVVLGVKNPLESPA