Protein Info for CCNA_00898 in Caulobacter crescentus NA1000 Δfur

Annotation: ribosomal large subunit pseudouridine synthase F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF01479: S4" amino acids 13 to 58 (46 residues), 49.6 bits, see alignment 2.7e-17 PF00849: PseudoU_synth_2" amino acids 75 to 214 (140 residues), 54.5 bits, see alignment E=1.6e-18 TIGR00093: pseudouridine synthase" amino acids 117 to 245 (129 residues), 127.1 bits, see alignment E=2.7e-41

Best Hits

KEGG orthology group: K06182, ribosomal large subunit pseudouridine synthase F [EC: 5.4.99.12] (inferred from 100% identity to ccr:CC_0855)

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4W2 at UniProt or InterPro

Protein Sequence (255 amino acids)

>CCNA_00898 ribosomal large subunit pseudouridine synthase F (Caulobacter crescentus NA1000 Δfur)
MAFTRTYDEAEPQRVNKWLAQSGVCSRREAEQLISDGLVSIDGEVVEDVGRKIQPGQTLT
LADRATAKLDAVPTYLVHKPRGVVSSQPDPGQVPAARLLTRANLWGDARGVAIPQSGDLI
PPIGRLDKDSRGLLLLSQDGVVAKAVIGPQSELEKEYRVAVMGELTEEKLELLRFGLELD
GRELRPAEVEVISDQRLSFVLREGRNRQIRRMCELVDLKVVDLFRVRVGPLDLGDMPEGH
WRLLTAAERAALVAG