Protein Info for CCNA_00876 in Caulobacter crescentus NA1000 Δfur

Annotation: 7,8-dihydro-8-oxoguanine-triphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00586: mutator mutT protein
  • amino acids 7 to 131 (125 residues), 106 bits, E=7e-35
• PF00293: NUDIX
  • amino acids 8 to 130 (123 residues), 88.3 bits, E=4.7e-29
• PF14815: NUDIX_4
  • amino acids 10 to 127 (118 residues), 99.4 bits, E=1.1e-32

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 100% identity to ccs:CCNA_00876)

Predicted SEED Role

"5-methyl-dCTP pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

See A0A0H3C810 at UniProt or InterPro

Protein Sequence (134 amino acids)

>CCNA_00876 7,8-dihydro-8-oxoguanine-triphosphatase (Caulobacter crescentus NA1000 Δfur)
MTKPIVLVAAAALIDVDGRVLICQRPQGKQLAGLWEFPGGKVEAGETPEQCLIRELQEEL
GIKVAQACLAPFVFASHSYESFHLLMPLYLLRRWEGQVTRKEHEALAWVKPDKLSDYPMP
PADEPLVAWLRDVL