Protein Info for CCNA_00809 in Caulobacter crescentus NA1000 Δfur

Annotation: quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 121 to 137 (17 residues), see Phobius details PF08240: ADH_N" amino acids 34 to 94 (61 residues), 42.9 bits, see alignment E=5.7e-15 PF00107: ADH_zinc_N" amino acids 158 to 278 (121 residues), 92.4 bits, see alignment E=3.3e-30 PF13602: ADH_zinc_N_2" amino acids 203 to 329 (127 residues), 57.5 bits, see alignment E=4.6e-19

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 100% identity to ccs:CCNA_00809)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6C3 at UniProt or InterPro

Protein Sequence (331 amino acids)

>CCNA_00809 quinone oxidoreductase (Caulobacter crescentus NA1000 Δfur)
MNTQPTMRALVVEDLAPNYAGCAVREVATPQPGPGEALVRVRAASVNFPDLLMTRGEYQL
KPPLPFTPGLDLAGEVVALGEGVTGLSVGDAVVGGARLGGFAEYAVLSAGALKPKPARLS
FAEAAAYGAAYLTAYVALVRRARLEPGEWVLVHGAAGGVGLAAVDLAKALGARVIATSAS
DAKLAQVKVLYAPDAVVNVTEGFRDQVKAITGGHGADVIYDPVGGDVFDESVRCIAFDGR
LLVIGFTSGRIPNVSVNMPLIKGFSVMGVRAGEYGRQFPEKGRENADAIWTMANEGVIRP
HVHAELPLDRWREAFDLLAERKVVGKAVITP