Protein Info for CCNA_00795 in Caulobacter crescentus NA1000 Δfur

Annotation: two-component response regulator FixJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF06490: FleQ" amino acids 7 to 119 (113 residues), 25.8 bits, see alignment E=2.2e-09 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 101.2 bits, see alignment E=7.7e-33 PF00196: GerE" amino acids 140 to 195 (56 residues), 69 bits, see alignment E=4.2e-23

Best Hits

Swiss-Prot: 53% identical to FIXJ_RHIME: Transcriptional regulatory protein FixJ (fixJ) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K14987, two-component system, LuxR family, response regulator FixJ (inferred from 100% identity to ccs:CCNA_00795)

Predicted SEED Role

"Two-component nitrogen fixation transcriptional regulator FixJ" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6K9 at UniProt or InterPro

Protein Sequence (202 amino acids)

>CCNA_00795 two-component response regulator FixJ (Caulobacter crescentus NA1000 Δfur)
MTDAPVVHVVDDDESARESLAFLLESADFEVVAYASAPAFLDALPQARPGVVITDVRMPE
MSGQDLVARLSALKVKMPIVMITGHGDIPMAVEAMRSGVIDFLEKPFSESRMLDALKRAF
ATVEAAPVSDDQAVILKRIESLSERERQVLDGVVAGHANKVIARDLGISPRTVEIYRAKL
MTKMQADNLAALVRMTLSVRGG