Protein Info for CCNA_00778 in Caulobacter crescentus NA1000 Δfur

Annotation: GTP-binding protein TypA/BipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 TIGR00231: small GTP-binding protein domain" amino acids 2 to 138 (137 residues), 86 bits, see alignment E=2.4e-28 PF00009: GTP_EFTU" amino acids 2 to 197 (196 residues), 179.1 bits, see alignment E=1.4e-56 TIGR01394: GTP-binding protein TypA/BipA" amino acids 3 to 605 (603 residues), 949.9 bits, see alignment E=4.6e-290 PF03144: GTP_EFTU_D2" amino acids 223 to 295 (73 residues), 43.4 bits, see alignment E=7.6e-15 PF00679: EFG_C" amino acids 404 to 488 (85 residues), 70.6 bits, see alignment E=1.9e-23 PF21018: BipA_C" amino acids 491 to 599 (109 residues), 162.2 bits, see alignment E=6.5e-52

Best Hits

Swiss-Prot: 51% identical to TYPA_HELPY: GTP-binding protein TypA/BipA homolog (typA) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K06207, GTP-binding protein (inferred from 100% identity to ccs:CCNA_00778)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6J8 at UniProt or InterPro

Protein Sequence (610 amino acids)

>CCNA_00778 GTP-binding protein TypA/BipA (Caulobacter crescentus NA1000 Δfur)
MSMRNIAIIAHVDHGKTTLVDQLLAQSGVFRANEATTERAMDSNDQERERGITILAKCTS
VLWNGEAGETRINIIDTPGHADFGGEVERILGMVDGCVLLVDAEEGVMPQTKFVLTKALK
MGLRPILCINKVDRAHADPDRVHNAAFDLFAAIGATDEQLDFPHIYASGRAGWATLDLNQ
PSDNLAPLFDLIVRHVPEPKQIAKKDEPFQILSVLIESDPFLGRLLTGRIESGKAVPGMA
IKALDRDGKEIERGRITKVLAFRGLKRQPIDDGAEAGDIVAIAGLSKATVADTLCALDVN
EALPAQPIDPPTISMTVSVNDSPLAGREGDKVQSRVIRDRLLKEAESNVAIRVTETSERD
AYEVAGRGELQLGVLIENMRREGFEVSISRPRVVYQTGENGERLEPMEDVMIDVDDEFTG
IVIEKLSARKAELKDMGPSGAGKTRITLLSPSRSLIGYQGEFLTDTRGSGVLNRVFSHYE
PHKGPIDQQRKGVLVSNSDGETAAYALWNLEERGVMFVGAGEKTYQGMIIGENSRSDDLD
VNPMKAKQLTNVRASGKDESIRLTPPRRMTLEQAIAYIEDDELVEVTPKNIRLRKQVLNP
SFRKKRTKED