Protein Info for CCNA_00766 in Caulobacter crescentus NA1000 Δfur

Annotation: cobalamin adenosyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF01923: Cob_adeno_trans" amino acids 7 to 176 (170 residues), 209.5 bits, see alignment E=1.9e-66 TIGR00636: ATP:cob(I)alamin adenosyltransferase" amino acids 8 to 187 (180 residues), 220.3 bits, see alignment E=6.9e-70

Best Hits

Swiss-Prot: 51% identical to PDUO_MYCLE: Corrinoid adenosyltransferase (ML1149) from Mycobacterium leprae (strain TN)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0729)

Predicted SEED Role

"ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" (EC 2.5.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C685 at UniProt or InterPro

Protein Sequence (192 amino acids)

>CCNA_00766 cobalamin adenosyltransferase family protein (Caulobacter crescentus NA1000 Δfur)
MVTLNRIYTRTGDGGTTRLATGAPVSKASLRVDSYGGVDETNAAIGQARQHTAADPVLDA
ILERIQNDLFDLGADLATPEQHGKPEWEPLRVVESQVERLEREIDQLNGEMSALTSFVLP
GGSPAAAALHVARTVCRRAERGVVALSEMDGEIVGTPAIKYLNRLSDLLFVAARWANDKG
QADVLWKPGATR