Protein Info for CCNA_00646 in Caulobacter crescentus NA1000 Δfur

Annotation: nitrate transport permease protein nrtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 84 to 285 (202 residues), 318.6 bits, see alignment E=8e-100 PF00528: BPD_transp_1" amino acids 120 to 278 (159 residues), 100.7 bits, see alignment E=4.2e-33

Best Hits

Swiss-Prot: 61% identical to NRTB_SYNY3: Nitrate import permease protein NrtB (nrtB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to ccr:CC_0610)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6A1 at UniProt or InterPro

Protein Sequence (296 amino acids)

>CCNA_00646 nitrate transport permease protein nrtB (Caulobacter crescentus NA1000 Δfur)
MAYPKPVFSPASPTSPPSLEPTPAPSRPSILPELGRRAAAVAATTLPPLVTVLVILGVWQ
AIVGESYTGLPSPKQVWLESKELILNPFYDNGGVDKGLFWHVATSLQRVGIGFSISAVVG
VLLGVFVGSNRWAHRSLDPIFQVLRTVPPLAWLPISLAAFHQAQPSALFVIFITAIWPII
INTAVGVRNIPSDYVNVAKVLRLSPVEYFFKILLPATTPYIFTGLRIGIGMSWLAIVASE
MLLGGVGIGFFIWDQYNASRISDILVGLAWVGLTGFFLDRLVALVGHVVSRGSAAS