Protein Info for CCNA_00629 in Caulobacter crescentus NA1000 Δfur

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details PF00015: MCPsignal" amino acids 433 to 586 (154 residues), 102.6 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to ccs:CCNA_00629)

Predicted SEED Role

"methyl-accepting chemotaxis protein McpK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C572 at UniProt or InterPro

Protein Sequence (628 amino acids)

>CCNA_00629 methyl-accepting chemotaxis protein (Caulobacter crescentus NA1000 Δfur)
MARREDREKGRSMFELLNSRLSIGKKLGLMALVLLAPLALMTFIYVQQVMKEVSFAQKER
AGVEWLRKAWPQALSIYASAGQTGGASPAGAEDFSAEAAAQALQGATPDQRGEAMNKLIA
AVADGSNLTLDPDLDSYYAMDAAVIGLPNLARTIGVRHNQITLEDRAVNSAQIKDALDRT
KASVEAAVANDKSRAVAAGLSASLRQLETAVSAVMAASDPTSPEAIAAERVALNAIDALW
RADTVVLDTMLENRQQAAMTDLFVRLGVVAAFLALAVLLAVQLAFGIQRRIGGLLAVIDK
LRADDLDVHTPFTRDQNEMGRLAVALEDFKGNLKAARETTAQSEIAKREAVRAMADQFEA
DVGAVVALVAEKADELELTARALADTASRTSEQSATVAAAAEEATTSVAVVASSTDEMGK
SVNEIAHQVNHSTSIAAQAVDRARRTSETIDRMSVSAQKIGEVVNLISEIAGQTNLLALN
ATIESARAGEAGRGFAVVAAEVKGLATQTAKATEDIAAQIHEIQNITSDSVSAISEIQRI
IDEMNAVSTAINAAVEEQSAATREIARNTSEAANGAQDVSRNISDVLHGAQQTGSASHQV
VSASQELGRQAAALRDRVDTFLKTVRAA