Protein Info for CCNA_00609 in Caulobacter crescentus NA1000 Δfur

Annotation: PurR-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00532: Peripla_BP_1" amino acids 69 to 327 (259 residues), 57.5 bits, see alignment E=3.2e-19 PF13407: Peripla_BP_4" amino acids 71 to 320 (250 residues), 42 bits, see alignment E=1.7e-14 PF13377: Peripla_BP_3" amino acids 184 to 330 (147 residues), 51.8 bits, see alignment E=2.1e-17

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to ccs:CCNA_00609)

Predicted SEED Role

"FIG00483952: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C549 at UniProt or InterPro

Protein Sequence (348 amino acids)

>CCNA_00609 PurR-family transcriptional regulator (Caulobacter crescentus NA1000 Δfur)
MIQSKKAHVRLIDIAKRLGLSSMSVSKALRGHADMAPETVERVKRVAAEMGYVPNHFARS
LQAQGGSKLLGVVVPKIRHAFFAESLGAIQEAAAEQGYEILFGVSQEQPSVERRHVETFV
SMRVEGLLVSVSERRDELLSDYRWLAPRGVPLVYFDRAPCDLQSFEAVTMDDRGGAHDAV
LAAAALGRTRIAHLAGYDAINIGRERRAGYEAGMRAAGLSINPDWVITGGLAEADGYQAF
ERLWSQAERPDAIFCASFPLAVGVADAMRALAPEAIGKVLLMFFGVAEMARFFPEPYICV
VQPAAAMGRVAVDRILHLIQDREMERHPPLPVHLMASPALSAPLTSRH