Protein Info for CCNA_00590 in Caulobacter crescentus NA1000 Δfur

Annotation: FixC-family flavoprotein dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF01494: FAD_binding_3" amino acids 4 to 315 (312 residues), 61.7 bits, see alignment E=3.5e-20 PF00890: FAD_binding_2" amino acids 6 to 39 (34 residues), 21.3 bits, see alignment 6.4e-08 PF01134: GIDA" amino acids 6 to 36 (31 residues), 24.9 bits, see alignment (E = 4.6e-09) PF04820: Trp_halogenase" amino acids 6 to 81 (76 residues), 27.2 bits, see alignment E=8.2e-10 amino acids 97 to 322 (226 residues), 38.3 bits, see alignment E=3.7e-13 PF13450: NAD_binding_8" amino acids 9 to 39 (31 residues), 22.1 bits, see alignment (E = 6.6e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00590)

Predicted SEED Role

"Dehydrogenase flavoprotein LodB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C793 at UniProt or InterPro

Protein Sequence (369 amino acids)

>CCNA_00590 FixC-family flavoprotein dehydrogenase (Caulobacter crescentus NA1000 Δfur)
MGARCDVAVIGAGPAGCAAAIALKRLGVASVLLLEAGDGARPRFGESLPPDIRLILAQLG
LAEAFAALGFDPCVGAASSWGEDGLGYNDFLFNPHGLGWHIDRARFDAFLRDAAVAAGAE
LRFDTVFDSVVMTGDAARLRVRGERGDETITAGFVLDATGRAARVARALGAERIESDRLV
CAAALIRIDPDGLLGQRSLLEAVDYGWWYAARLSPDEAIVVVSTDADLLRARRLHRSDAW
YGHLAATRHVAAALGTAAPPSQLMVRQARSSRLSRAADQRWRAIGDAASVYDPIMAQGVT
KAMIEGLAAARDIVRHMPDAEEGLDARFADYLSLRDYFYGQEGRWPDAPFWTRRRRPQPA
VRTLWEVSA