Protein Info for CCNA_00575 in Caulobacter crescentus NA1000 Δfur

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 45 to 69 (25 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 7 to 165 (159 residues), 40.3 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00575)

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5T0 at UniProt or InterPro

Protein Sequence (372 amino acids)

>CCNA_00575 hypothetical protein (Caulobacter crescentus NA1000 Δfur)
MSQPAARFLSLDVFRGLTVFLMIVVNTAGPGAKAYSQLVHAPWFGFTAADAVFPSFLFAV
GCSMAFAFSKPIPLNDFTVKVLRRAALIFLLGFLMYWFPFVRKVDGDWALIPFSDTRVMG
VLQRIALCYLLAAFAVRWLSPRLIVALCAVLLLGYWAILMAFGDPAAPLSKLGNAGTRLD
LLLIGQNHLYRKDGGFDPEGLLGTLPSTVNVLAGYLAARFLKENPGSSQAMGRMAIAGLV
LILAGLVWSPLFPIAKKLWTSSFVLLTVGIDLILLAGLAKLLEGKASNPGTYFFQVFGLN
PLVLYLFSELFVVVLGMIEVAPGVGIYEWVGVNLFQAVMPGAFGSLLCALAYTLVCWLLG
YVMARRGVVVKL