Protein Info for CCNA_00564 in Caulobacter crescentus NA1000 Δfur

Annotation: sensory transduction protein kinase CenK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 176 to 204 (29 residues), see Phobius details PF02518: HATPase_c" amino acids 369 to 477 (109 residues), 73.9 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00564)

Predicted SEED Role

"FIG00481115: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C509 at UniProt or InterPro

Protein Sequence (501 amino acids)

>CCNA_00564 sensory transduction protein kinase CenK (Caulobacter crescentus NA1000 Δfur)
MVEPGSPSEDKTQKPRKRFPWPGGLSARLLLFTAVVVNFGGLLILPPALAAYEEQWLLDR
VRAGELASTIAESDPELRVSDAVANQMFDQAGAVTVAVQVDGARRLVLPPKQPFETPYLV
DLRRQNPGSWLAAPFYTLTSPKGSMVRVMAEPRFRKAEFIEVVLPDAPLKARLVAYFWQL
AGVTIFVATLAGVLVYAFLNIFLVRPMQRITRAMEAFRSDPDDPAARIVLSNRRDEIGRA
ELELDRMQADLLAALSSKARLAALGEAVAKINHDLRNMLTSAQMASDRLAALGDPKVAQA
LPRLERALDRAINLASDVMAYGKSKEPEPVIRVIPLRPALDMAAEDAGLSAQGVSLETVI
GPREQVLADPDQLHRILTNLLRNAREAIEGAPDRGGKGKVFVELRRADGSSVLRLSDDGP
GVPERARANLFQPFVGSVRRGGTGLGLAIARELAQGHGGDLALVETGPGGSVFDLTLSGA
PDPLPETPSEPGDRAADAPAG