Protein Info for CCNA_00563 in Caulobacter crescentus NA1000 Δfur

Annotation: SNARE-associated family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 59 to 82 (24 residues), see Phobius details amino acids 87 to 88 (2 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details PF09335: VTT_dom" amino acids 78 to 191 (114 residues), 73.1 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0529)

Predicted SEED Role

"COG0398: uncharacterized membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C414 at UniProt or InterPro

Protein Sequence (245 amino acids)

>CCNA_00563 SNARE-associated family membrane protein (Caulobacter crescentus NA1000 Δfur)
MSRDEVLTRMRRFGPLAVVAVLCAAAFASGLVEHISLEELRLRGTQLQAFAHENPLLCAA
IYLAVYVGTVAISLPGALILSLTGGFLFGPIGGGLAAVTGATGGSTVTFLVFRTAFGEAL
PFKSSAFIARIAEGLKGDAFNYLLTLRLIPAFPLLAVNVAAGVMNVRVRTFLLASVLGMI
PSSFVYAGIGAGLGHVFAKGGPVTVESLLSPRIYLPIIGMGVLAFLPPLWRHWRNGRDVA
SLDEK