Protein Info for CCNA_00559 in Caulobacter crescentus NA1000 Δfur

Annotation: homoserine O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR01392: homoserine O-acetyltransferase" amino acids 20 to 372 (353 residues), 476.9 bits, see alignment E=1.9e-147 PF00561: Abhydrolase_1" amino acids 50 to 326 (277 residues), 69.5 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 100% identical to METXA_CAUVN: Homoserine O-acetyltransferase (metXA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00641, homoserine O-acetyltransferase [EC: 2.3.1.31] (inferred from 100% identity to ccs:CCNA_00559)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GZZ0 at UniProt or InterPro

Protein Sequence (382 amino acids)

>CCNA_00559 homoserine O-acetyltransferase (Caulobacter crescentus NA1000 Δfur)
MAALDPITPAGGGTWRFPANEPLRLDSGGVIEGLEIAYQTYGQLNADKSNAVLICHALTG
DQHVASPHPTTGKPGWWQRLVGPGKPLDPARHFIICSNVIGGCMGSTGPASINPATGKTY
GLSFPVITIADMVRAQAMLVSALGVETLFAVVGGSMGGMQVQQWAVDYPERMFSAVVLAS
ASRHSAQNIAFHEVGRQAIMADPDWRGGAYAEHGVRPEKGLAVARMAAHITYLSEPALQR
KFGRELQRDGLSWGFDADFQVESYLRHQGSSFVDRFDANSYLYITRAMDYFDIAASHGGV
LAKAFTRARNVRFCVLSFSSDWLYPTAENRHLVRALTAAGARAAFAEIESDKGHDAFLLD
EPVMDAALEGFLASAERDRGLV