Protein Info for CCNA_00501 in Caulobacter crescentus NA1000 Δfur

Annotation: glucosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 182 to 211 (30 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 334 to 352 (19 residues), see Phobius details amino acids 359 to 382 (24 residues), see Phobius details amino acids 388 to 410 (23 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details PF02366: PMT" amino acids 92 to 244 (153 residues), 28.5 bits, see alignment E=5.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00501)

Predicted SEED Role

"4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family" in subsystem Pterin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C602 at UniProt or InterPro

Protein Sequence (559 amino acids)

>CCNA_00501 glucosyltransferase (Caulobacter crescentus NA1000 Δfur)
MTLESRLDAWSRGWRAPLFAALVALIAGLPGLFAMPPLDRDESRFAQATSQMLETGDYVV
IKFQDQPRFKKPVGIHWMQALSVTALSDAEARQIWAYRIPSLLGAMLAAAACAWGAAALF
DARTGLLAGSILGATFLLSSEAFIAKTDAALCGATTLAMAALARVYMGHLKGEPSSKWTK
LAFWLGLALAALIKGPVGLLVALFALLMLAIWDRKAGWMKDLGWTWGLILFAAITLPWAM
MITVATDGAFWGAAVGADLAPKLAGGQEGHSGPFGYHTLLAPLLSFPATLLLPAALVVGW
SQRNEPGVRFALCWLIPTWLMFELLPTKLVHYELPAYGALAMLMAAAVRAPIGARSRWIG
GGLSVLMGAVLAAVAIYGQTAFGGTGDLVWTIIAAGLAFGAGLVGAVLLLRRQSVRALVF
AGALGVGAHIALTAGLIPRLEPLFLSKDLAKALDSARLSPRSGAPGPVAVTGYAEPSMIF
QLGTTTELTDGAGAAQAVAEGRPAIVEAREEKPFQAALAKLGLTAKPAAVVEGLNYSDGD
EERLTIYRGEPIAPQEAQP