Protein Info for CCNA_00474 in Caulobacter crescentus NA1000 Δfur

Annotation: DNA relaxase/conjugal transfer nickase-helicase trwC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 936 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF08751: TrwC" amino acids 34 to 306 (273 residues), 293.6 bits, see alignment E=4.9e-91 TIGR02686: conjugative relaxase domain" amino acids 36 to 310 (275 residues), 271.8 bits, see alignment E=3.9e-85 PF13604: AAA_30" amino acids 460 to 641 (182 residues), 160.9 bits, see alignment E=7.7e-51 PF13245: AAA_19" amino acids 468 to 589 (122 residues), 56.7 bits, see alignment E=7.8e-19 PF22232: TraI_hel_assoc_N" amino acids 482 to 580 (99 residues), 110 bits, see alignment E=2e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00474)

Predicted SEED Role

"IncW plasmid conjugative relaxase protein TrwC (TraI homolog)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C3T6 at UniProt or InterPro

Protein Sequence (936 amino acids)

>CCNA_00474 DNA relaxase/conjugal transfer nickase-helicase trwC (Caulobacter crescentus NA1000 Δfur)
MGRRQIPGCRARVQLERRRTGLMVASLSSLSSSAQASSYYEADDYHAEGGAAPSRWQGSG
AAALGLEGEVDPERFRQLLDGVLSDHVALGARRDEGRQHRPGWDLTLSAPKSISIMALVA
GDRRLHAAHAAAVEAALAFTERHAGGTRIRDGERVAHVRTGALAMATFQHETSRAQDPQL
HTHAVILNMTRDLEGTWRSLDSRALYQLQKTIGEVYRQELAGAVRALGYAIEVGKESMFE
ISDVPASVREAFSERARQVEAHLATKGLTRATATAEEKQAATLYTRASKKAADRAELSRA
WRVEADGLGFSSEARRSLLTEALDRAEASKAIRDRGAVLAQDAVRFAAEKLGERQAIFSR
AELEREAGRKAIGLATRTEIMAAVDKRQQSHQLEARALRSPIGLDLEGFTTDRAIAHEKR
LLEIEREGRNALAPIVPPIEASRIINAASLAASERGLAWSDDQRRATKAVLTSRSAVVGV
QGFAGTAKTTTVLATLAKAAAEQGYQVKALAPSASAAITLGEALDLEGRTIARHLVERPN
ARPSARELWIVDEASLVSARDMARLLDEAQRRGARTLLVGDAHQLGSVGAGAAFRQLQDA
GLETAHLTKIVRQSNTLTLEAVEATLAGHARRAFDALDRGGGQIIEAQSVEDRQALIAAH
FAQLDSAQRRRTLIIDPSREGREQLTARIRAELIAAGHLGKAAVTVTSLVAKDLTQAERK
EAGSYAPGDIVTFARTLTGKAVAKDTAYEVQAVDARRRTVTLSDGRDARIDWAPHRWGSA
EAFEPVDRELRQGDRIEFTRNNMRLHQVNGLQGEIVSLDVEARKAQVRTDRGHIRTLDLN
ALQDRHFRHAYVQTAFAAQGRTTDHVLFHAESQRSNLIDQATLYVAISRARHGATIVTDD
RAKVIRGVEARSGRRLTALGAEGSGREAGLDQDAGL