Protein Info for CCNA_00455 in Caulobacter crescentus NA1000 Δfur

Annotation: N-acetyl-glucosamine/N-acetyl-chitin oligosaccharide outer membrane transporter nagA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 889 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01782: TonB-dependent receptor" amino acids 33 to 889 (857 residues), 647.6 bits, see alignment E=1.8e-198 PF07715: Plug" amino acids 52 to 162 (111 residues), 55.2 bits, see alignment E=1.4e-18 PF00593: TonB_dep_Rec" amino acids 426 to 856 (431 residues), 148.9 bits, see alignment E=6.4e-47 PF14905: OMP_b-brl_3" amino acids 567 to 868 (302 residues), 61.1 bits, see alignment E=1.6e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0446)

Predicted SEED Role

"N-acetylglucosamine-regulated TonB-dependent outer membrane receptor" in subsystem Chitin and N-acetylglucosamine utilization or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6W8 at UniProt or InterPro

Protein Sequence (889 amino acids)

>CCNA_00455 N-acetyl-glucosamine/N-acetyl-chitin oligosaccharide outer membrane transporter nagA (Caulobacter crescentus NA1000 Δfur)
MKTIRKSVLAASASAMVVMIAAPAMAQSGGNEVEQVVITGIRASLLQSIESKRKADAIVD
VVTAEDVGKFPSTNVAEALTIVPGVTVDRAFGQGEKVSILGTDPALNRTLLNGQTVASAD
WFILDSPGRTFNYALLAPQIVGKVDVYKSPEARIDEGSIGGTVIVNTRKPLDLKSGTIAG
AVSYLYTDRSKKGDLQGSLLASWKNADSTFGASFSIQRAEDQLRRDGVETYGTIAANQWA
GGNPDNPVDSRTKGCVGSCASTLTANLGARSPNAFGASYFEQGRTRTTYTTALQYKPNDQ
LSLEFNWLKIDADYDNTNQSMYAFQGNTWNSLGALTGLTVNNGVVSKASFNNALSVLDVQ
HREAGLKSDTFHLKGGYKGDGWDLNGEVGKSTADGGTKRQVFLEFLNWASYTVDISGAPK
SPGSLTYTTNVLGNPSAFATDPGWSGNLVSKPTSDEEKYAQFDFGKDFDGVIQRVQVGYK
RREHQTGQQYAGIAITGVAAPASSFNPSTVPSNYLKGFDGVGTQMQNRFRIDGNAMVSYV
ESGKWLAAGATMPKPSIFAAAEFTAGNWNIQEDIDALYAQANFKADNVRGNFGVRYVKTS
VDSAGYVCKPGAACNKAADWSWKSTKKSYDNVLPSVNIIVDAREDLVLRFAAAQVIARPN
YSDMTNYFWLSDGILTGGGGNPALEPYKSSNFNASAEWYFQPQAILSAEVFYKDISNYIL
QRTQPESYFNQSQGKVTTYQISRPFNAGSAEVKGLAMAYQQTFGGGFGLLANYTYADASG
QSGAPLPYSSKNQVNLSPFYENGPFSARATFTWRSKYFTGVDRGDDMFVKAAKTLDATVG
YAVTKNITMSLSGQNLLDSEYYAYANTTALPRGVYRTGRKLQATLNVAF