Protein Info for CCNA_00435 in Caulobacter crescentus NA1000 Δfur

Annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 110 to 135 (26 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details amino acids 428 to 447 (20 residues), see Phobius details amino acids 453 to 472 (20 residues), see Phobius details PF13520: AA_permease_2" amino acids 34 to 450 (417 residues), 186.1 bits, see alignment E=1.1e-58 PF00324: AA_permease" amino acids 38 to 444 (407 residues), 121.5 bits, see alignment E=4.2e-39

Best Hits

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 100% identity to ccs:CCNA_00435)

Predicted SEED Role

"amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C3Q5 at UniProt or InterPro

Protein Sequence (483 amino acids)

>CCNA_00435 amino acid transporter (Caulobacter crescentus NA1000 Δfur)
MVGGTPKVSFWTRRKAIDTITAGHADSHQLKKTLSWPHLVALGVGAIVGTGIYTLTGVGA
GLAGPGVILSFLIAGAVCACAALCYAELSTMIPASGSAYTYSYAAMGEPVAWFVGWSLIL
EYTLVCAAVAVGWSAHAHGLFKMIGFPDALLAGPHQGGLINMPAVFISMAVAGLLALGTR
ESATVNMVLVFVKIIALIVFVVLCLPAFNLAHFTPFMPNGFQAHVPEGAAADAAKVGVMA
AASLIFFAFYGFDAVSTAAEETKNPKRDLTIGIVGSMAVCTAIYMIVAAVSIGASRTEVF
SKSEAPLVFILESLNHGKIAQLVALAAVIALPTVILAFMYGQSRIFFVMARDGLLPRALS
KVNAKTGTPVMMTLLTGVLAAVISGLLSLKDIAELANAGTLWAFIAVGASVILLRLREPN
RPRVFSTPLWPIVAPAGILGCLYLFLSLPGKTQLYFLYAHLIGAVVYLAYGMRKSVLAQQ
ERA