Protein Info for CCNA_00434 in Caulobacter crescentus NA1000 Δfur

Annotation: conserved membrane-spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 16 to 43 (28 residues), see Phobius details amino acids 64 to 93 (30 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 252 to 276 (25 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 1 to 291 (291 residues), 272.3 bits, see alignment E=2.2e-85

Best Hits

Swiss-Prot: 40% identical to Y5671_RHIME: UPF0324 membrane protein RB0971 (RB0971) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00434)

Predicted SEED Role

"FIG00482925: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6V3 at UniProt or InterPro

Protein Sequence (311 amino acids)

>CCNA_00434 conserved membrane-spanning protein (Caulobacter crescentus NA1000 Δfur)
MAVLAKLLSQSLHAPAPLLAVVLGMMLGALGLQGQLGAGLDVFAKPGLRLGVAMMGAQIS
WSEFAALGGPAVLASGAVVLGGLGIGALAGAALGLPLAEALIAAAACSICGASAALAASQ
AAPSSPENQRTTALVIVGVNLLSTVAMLAYPPIANALGLTAHQAGVFFGLSIHDVAQVAG
AGASVSPEVAGTAALAKLSRILWLGPAVVLIGLMLTRTAQGGRISGLQAPPLFVWGFAAL
AAARGLNLIPPALVSALGACSGFLLLAGVGAISAKLGPKALLEVKPRLAILLVTLTVAVA
ILAYALTRIFF