Protein Info for CCNA_00382 in Caulobacter crescentus NA1000 Δfur

Annotation: adenine-specific methyltransferase ccrM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF01555: N6_N4_Mtase" amino acids 25 to 247 (223 residues), 240.7 bits, see alignment E=1.8e-75 PF18755: RAMA" amino acids 263 to 355 (93 residues), 70.7 bits, see alignment E=9.3e-24

Best Hits

Swiss-Prot: 100% identical to MTC1_CAUVN: Modification methylase CcrMI (ccrMIM) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K13581, modification methylase [EC: 2.1.1.72] (inferred from 100% identity to ccr:CC_0378)

Predicted SEED Role

"Modification methylase"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GZ33 at UniProt or InterPro

Protein Sequence (358 amino acids)

>CCNA_00382 adenine-specific methyltransferase ccrM (Caulobacter crescentus NA1000 Δfur)
MKFGPETIIHGDCIEQMNALPEKSVDLIFADPPYNLQLGGDLLRPDNSKVDAVDDHWDQF
ESFAAYDKFTREWLKAARRVLKDDGAIWVIGSYHNIFRVGVAVQDLGFWILNDIVWRKSN
PMPNFKGTRFANAHETLIWASKSQNAKRYTFNYDALKMANDEVQMRSDWTIPLCTGEERI
KGADGQKAHPTQKPEALLYRVILSTTKPGDVILDPFFGVGTTGAAAKRLGRKFIGIEREA
EYLEHAKARIAKVVPIAPEDLDVMGSKRAEPRVPFGTIVEAGLLSPGDTLYCSKGTHVAK
VRPDGSITVGDLSGSIHKIGALVQSAPACNGWTYWHFKTDAGLAPIDVLRAQVRAGMN