Protein Info for CCNA_00376 in Caulobacter crescentus NA1000 Δfur

Annotation: putative membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 190 to 217 (28 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF01925: TauE" amino acids 10 to 245 (236 residues), 165.7 bits, see alignment E=7.2e-53

Best Hits

Swiss-Prot: 53% identical to YCB9_SINSX: Probable membrane transporter protein ORF9 from Sinorhizobium sp.

KEGG orthology group: K07090, (no description) (inferred from 100% identity to ccs:CCNA_00376)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C3G2 at UniProt or InterPro

Protein Sequence (259 amino acids)

>CCNA_00376 putative membrane spanning protein (Caulobacter crescentus NA1000 Δfur)
MVSLDILASLFVVAALAGALDAIAGGGGLITLPALLLAGLSPVQALGTNKLQGAISALSS
TSAFARRGLIDWKTALPVAGASALAGLGGALCASLLSPEFLRAVVPLMLIAIALYFGLSR
AIKAEDVTPRMALIPFACFVAPLIGFYDGIFGPGAGAFYMVAIVTLLGYGALKATAHTKL
ANAASNLGSLVLFTLKGAVVWPVGLVMAAGAFIGAQVGSRLAMRFGPKLIRPLLVVISCA
MAVKLLADPANPLRMALGF