Protein Info for CCNA_00356 in Caulobacter crescentus NA1000 Δfur

Annotation: outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF06629: MipA" amino acids 36 to 254 (219 residues), 180.9 bits, see alignment E=2.1e-57

Best Hits

Swiss-Prot: 100% identical to Y351_CAUVC: Putative outer membrane protein CC_0351 (CC_0351) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K07274, outer membrane protein (inferred from 100% identity to ccr:CC_0351)

Predicted SEED Role

"MltA-interacting MipA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C3D8 at UniProt or InterPro

Protein Sequence (254 amino acids)

>CCNA_00356 outer membrane protein (Caulobacter crescentus NA1000 Δfur)
MISLRTHAARSLLALGALAAATSAAAQSGAPDRAVVGIAAVYTPGYQGGDDYRLMPFPVI
DVTYGRFFASGREGVGYTVLDGSAVKVSAGATFVPGYRRRDAPVGVGRLDGGAGLRVAAD
MRLGEVLVSMSATKVVSGDVDGALVDASLAYPVRLSERLSLMPSVSATWADSQYNRAYFG
ISAAQSAASKLPVYRPGGGVKDVSMSLSANYRLNDKVSLGATASLSRLTGDARKSPIVVE
ATQPSAVLSVAYRF