Protein Info for CCNA_00351 in Caulobacter crescentus NA1000 Δfur

Annotation: primosomal protein N'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 PF17764: PriA_3primeBD" amino acids 7 to 97 (91 residues), 56.4 bits, see alignment E=5.4e-19 PF04851: ResIII" amino acids 186 to 349 (164 residues), 42.4 bits, see alignment E=1.8e-14 PF00270: DEAD" amino acids 190 to 354 (165 residues), 73.5 bits, see alignment E=4.4e-24 TIGR00595: primosomal protein N'" amino acids 210 to 716 (507 residues), 567.5 bits, see alignment E=1.2e-174 PF00271: Helicase_C" amino acids 499 to 581 (83 residues), 32.8 bits, see alignment E=1.8e-11 PF18074: PriA_C" amino acids 625 to 715 (91 residues), 58 bits, see alignment E=3.5e-19

Best Hits

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 100% identity to ccs:CCNA_00351)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C3D4 at UniProt or InterPro

Protein Sequence (719 amino acids)

>CCNA_00351 primosomal protein N' (Caulobacter crescentus NA1000 Δfur)
MPRIASVLLPMPLPEAFDYAEPEGLALAVGDHVTVPLGPRVIRGVVTALRDGTGGNRPLK
PVLERVDDPPLPPGALAFVEWAARYSVDVPGWPLAMALRGLRHPPPKPDKVLVLTGVQPA
RVTPARLKVMAAAEGTKLSGAALASAAGVSAGVVKGLVDEGVLAVDFVEPERGLPQPDLS
LPARALNPGQAACVDVLKDMLESGGFQAALLDGVTGSGKTEVYLEAVAEALKDPETQVLV
LLPEIALTQAVMARFEQRFGALPAEWHSGVSPPRRRQVWEAVAGGNARIVVGARSALFLP
FRKLRLIVVDEEHDSSFKQEEGFIYQARDLAVARAKIEGASVLLASATPSLESLYNAQTG
RYRWLRLSARHGAAQLPDIGLVDMRQTPPEPGRWLSPPLIKAMAVTLQRGEQAMLFLNRR
GYAPLVLCKACGEKMKSPDTDSWLVEHRYTGRLVCHLTGFSMKKPEACPHCGAKDSLVSI
GPGVERVEEEARHIFPDARVAVFSSDTVMDAEGAKALVSSMAAGEIDILVATQAAAKGHN
FPNLTLVGVVDADLSLRGGDLRAGERTFQLLAQAAGRAGRHEKPGRALLQTYAPDHAVMR
ALAAQDRDAFVEAEMAMREDAGLPPFGRLAAVIASGPDGAALDAYVEALAAVIPNAEGVE
VFGPADAPLALVRGRRRKRFLVRAERNVDLQGFMAAWRARAKVPNSVRVVIDVDPYSFL