Protein Info for CCNA_00323 in Caulobacter crescentus NA1000 Δfur

Annotation: low-affinity zinc transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF02492: cobW" amino acids 12 to 188 (177 residues), 203.7 bits, see alignment E=1.9e-64 PF07683: CobW_C" amino acids 271 to 362 (92 residues), 88 bits, see alignment E=3.1e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00323)

Predicted SEED Role

"Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C3B1 at UniProt or InterPro

Protein Sequence (365 amino acids)

>CCNA_00323 low-affinity zinc transport protein (Caulobacter crescentus NA1000 Δfur)
MTQTVPTSGKIPVTVLTGYLGAGKTTLLNRILTEEHGKRYAVIVNEFGEVGIDNDLVVGA
DEEVFEMNNGCVCCTVRGDLIRVLQGLMKRKGGFDAIIVETTGLADPGPVAQTFFVDDDV
KARTALDSVTAVVDAKHILLRLSDSKEAVEQIAFADQIVLNKTDLVSEDDLRHVEARIRR
INPLAPIHRAQRSNVPLDAILGKHSFDLERITDLEPDFLNPAHGEPGHVHDEHCDHHHHH
DHDHVHDEHCGHDHHHHHHDHKSDVHDDGVKGISLTLDKPVDGQKITAWLNDLLARRGPD
ILRAKGIIDVKGEDKRLVFQAVHMILEGDFQRPWTDKDKRYSRMVFIGRDLDEAELRAGF
EATAA