Protein Info for CCNA_00306 in Caulobacter crescentus NA1000 Δfur

Annotation: lysophospholipid acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 12 to 27 (16 residues), see Phobius details PF04028: DUF374" amino acids 73 to 145 (73 residues), 89.9 bits, see alignment E=3.1e-30

Best Hits

KEGG orthology group: K09778, hypothetical protein (inferred from 100% identity to ccs:CCNA_00306)

Predicted SEED Role

"Protein of unknown function DUF374" in subsystem Lipopolysaccharide-related cluster in Alphaproteobacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C491 at UniProt or InterPro

Protein Sequence (237 amino acids)

>CCNA_00306 lysophospholipid acyltransferase (Caulobacter crescentus NA1000 Δfur)
MKPLRSPWVMRALARFFSGYIALTYKTLRWTREGQAIADRVQAEALASGGGAILALWHSR
VPVGPATWPQGPDKPEIRVLVSQSRDGEFIARVIARLGLPSIRGSSLKKTDTAKNKGGEQ
AFRDMVKWVKDGGAMAITPDGPRGPVEVMQKGAVALARVSGAPVLFVGVAVNPCIRLKTW
DRTIIPLPFAKAAMVWDGPVHAGRDDDPDAVVEAWGARLSAVSRRAEAIVGETPPKD