Protein Info for CCNA_00293 in Caulobacter crescentus NA1000 Δfur

Annotation: phosphate transport system permease protein pstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 209 to 238 (30 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details PF11812: DUF3333" amino acids 19 to 164 (146 residues), 141 bits, see alignment E=3.4e-45 TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 190 to 428 (239 residues), 229.1 bits, see alignment E=2.8e-72 PF00528: BPD_transp_1" amino acids 228 to 428 (201 residues), 81.7 bits, see alignment E=5.9e-27

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to ccr:CC_0291)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C480 at UniProt or InterPro

Protein Sequence (431 amino acids)

>CCNA_00293 phosphate transport system permease protein pstA (Caulobacter crescentus NA1000 Δfur)
MTDANLGAAAPRQTLSAAEARLKKRHRAERLFKAQGVAAIIIAMIFLVVLVGRIVTQGYS
TFQTHTLSVAVYLNPERIDTSDLSGVNYDYIVAEAVMKKLGVQDDDFGTISTKVQDLVSR
DFGFQLLNKLKADQTLIGQTVTVTGPLKADADLYFKGQIERSTDEGDRKLDNQQLDWLDK
LQKDGAITSGFNTGFFTHSDSTEPEQAGVLGAVVGSAMMLLITALISVPVGVLAAVYLEE
FAPKNRWTDIIEVNINNLAAVPSIVYGLLGLALFINWLNVPRGSPLVGGLVLALMALPTV
IIATRSALKAVPPSIREAALGVGASKTQTVFHHVLPLAMPGVMTGAILSLAHALGETAPL
LMIGMVSFVPGVPEGFTSAATVLPVQVFIWENASERAFHERTAAAIIVLLVFMIVMNAAA
VILRRRFERRW