Protein Info for CCNA_00287 in Caulobacter crescentus NA1000 Δfur

Annotation: photosensory histidine protein kinase LovK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF13188: PAS_8" amino acids 24 to 79 (56 residues), 22.6 bits, see alignment 3.4e-08 TIGR00229: PAS domain S-box protein" amino acids 24 to 143 (120 residues), 59 bits, see alignment E=2.7e-20 PF00989: PAS" amino acids 26 to 132 (107 residues), 38.2 bits, see alignment E=5.9e-13 PF13426: PAS_9" amino acids 41 to 138 (98 residues), 83.6 bits, see alignment E=4.9e-27 PF08448: PAS_4" amino acids 43 to 140 (98 residues), 33.4 bits, see alignment E=2e-11 PF08447: PAS_3" amino acids 47 to 130 (84 residues), 39.2 bits, see alignment E=3.2e-13 PF07568: HisKA_2" amino acids 177 to 251 (75 residues), 84.6 bits, see alignment E=1.9e-27 PF07536: HWE_HK" amino acids 177 to 250 (74 residues), 27.2 bits, see alignment E=2.4e-09 PF13581: HATPase_c_2" amino acids 263 to 344 (82 residues), 42.1 bits, see alignment E=3.7e-14 PF02518: HATPase_c" amino acids 274 to 364 (91 residues), 43.8 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00287)

Predicted SEED Role

"FIG00481710: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C379 at UniProt or InterPro

Protein Sequence (368 amino acids)

>CCNA_00287 photosensory histidine protein kinase LovK (Caulobacter crescentus NA1000 Δfur)
MEDYSESRRAGERLAAGHGVDDPFAAAISATRMAMIVADATQPDIPIIFANDAFLRLTGY
ARDEVIGRNCRFLQGPDTDPKAIQAVRDALAAGEDVAVDLLNYRKDGSPFWNALNMSPVR
NDAGQLVYFFGSQVDVTDKKVVELRARDHSDGLQQMVEERTRELTEALKQKTALLHEVDH
RVKNNLQLISSLLLLQNRRVPDPAVKASLRGMLGRVNAIATVHRRLFQSEDVERFDVSAF
IRDMVADLMGSAMRDDIRVELDLERVEIPAAKAAPLALVVNELLTNALRHGFPEGRGGRI
FVGLSRLNGDFRIEITDDGVGQDRETRASGFGLTIVQLLCQQLKAKWETTDAEPGTRVVV
LLPINGTQ