Protein Info for CCNA_00281 in Caulobacter crescentus NA1000 Δfur

Annotation: methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF00551: Formyl_trans_N" amino acids 1 to 179 (179 residues), 141.9 bits, see alignment E=2e-45 TIGR00460: methionyl-tRNA formyltransferase" amino acids 1 to 298 (298 residues), 269.9 bits, see alignment E=1.4e-84 PF02911: Formyl_trans_C" amino acids 203 to 299 (97 residues), 71.2 bits, see alignment E=7.1e-24

Best Hits

Swiss-Prot: 100% identical to FMT_CAUVC: Methionyl-tRNA formyltransferase (fmt) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 100% identity to ccs:CCNA_00281)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GYF1 at UniProt or InterPro

Protein Sequence (308 amino acids)

>CCNA_00281 methionyl-tRNA formyltransferase (Caulobacter crescentus NA1000 Δfur)
MRIAFLGTPDFAVTCLAELVASGHEIVCVYSQPPAPRGRGQDLKPSPVHAFAEGLGLPVR
TPVSMKTPEEIAAFQALDLDAAVVVAFGQILVKDVLEAPKHGCFNLHASLLPRWRGAAPI
QRAIMAGDAVTGVQVMRMSEGLDEGPILMSQQVAIADDDTAASLHDKLAAVGARLLPVAL
AAIEREVVQETPQAEDGVTYAKKIKSAEARIDWTRPAAEIDRHIRGLSPFPGAWFEAPSE
KGPVRVKALLSRVEAASGVAGTTLDDALLIACGEGSIRLLKAQREGKGVQDAQTFTRGFP
IATGTVLA