Protein Info for CCNA_00270 in Caulobacter crescentus NA1000 Δfur

Annotation: Recombination protein recR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR00615: recombination protein RecR" amino acids 7 to 198 (192 residues), 196.5 bits, see alignment E=1.6e-62 PF21176: RecR_HhH" amino acids 9 to 52 (44 residues), 33.4 bits, see alignment 6.6e-12 PF02132: RecR_ZnF" amino acids 56 to 76 (21 residues), 22.7 bits, see alignment (E = 1.4e-08) PF13662: Toprim_4" amino acids 83 to 173 (91 residues), 79.6 bits, see alignment E=3.3e-26 PF21175: RecR_C" amino acids 175 to 198 (24 residues), 40.6 bits, see alignment (E = 2.9e-14)

Best Hits

Swiss-Prot: 100% identical to RECR_CAUVN: Recombination protein RecR (recR) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K06187, recombination protein RecR (inferred from 100% identity to ccs:CCNA_00270)

MetaCyc: 38% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GYE0 at UniProt or InterPro

Protein Sequence (200 amino acids)

>CCNA_00270 Recombination protein recR (Caulobacter crescentus NA1000 Δfur)
MAASAGPEIERLIALLSKLPGLGPRSGRRAALALLKKRDTLLAPLATAMAEAQAKVRTCG
TCGSLDVTDPCAVCADGSRDGRLLCVVEEVGSVWAMERGGSFKGRYHVLGGLLSALDGIG
PEALRIGELVGRVADGSVAEVILALPATVDGQTTAHYIADRLAKTNVPVTMLARGVPVGG
DLDWLDDGTIAQALRARRPA