Protein Info for CCNA_00268 in Caulobacter crescentus NA1000 Δfur

Annotation: DNA polymerase III subunit gamma/tau

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 TIGR02397: DNA polymerase III, subunit gamma and tau" amino acids 56 to 416 (361 residues), 400.3 bits, see alignment E=4.1e-124 PF13177: DNA_pol3_delta2" amino acids 73 to 235 (163 residues), 121.8 bits, see alignment E=1.2e-38 PF07728: AAA_5" amino acids 94 to 202 (109 residues), 30.1 bits, see alignment E=1.8e-10 PF13401: AAA_22" amino acids 94 to 209 (116 residues), 32.6 bits, see alignment E=3.6e-11 PF00004: AAA" amino acids 95 to 229 (135 residues), 40.8 bits, see alignment E=1.2e-13 PF13238: AAA_18" amino acids 95 to 186 (92 residues), 29.5 bits, see alignment E=4.1e-10 PF12169: DNA_pol3_gamma3" amino acids 291 to 431 (141 residues), 139.1 bits, see alignment E=3.9e-44 PF12362: DUF3646" amino acids 477 to 590 (114 residues), 119.8 bits, see alignment E=2.9e-38

Best Hits

KEGG orthology group: K02343, DNA polymerase III subunit gamma/tau [EC: 2.7.7.7] (inferred from 100% identity to ccr:CC_0267)

Predicted SEED Role

"DNA polymerase III subunits gamma and tau (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6E2 at UniProt or InterPro

Protein Sequence (608 amino acids)

>CCNA_00268 DNA polymerase III subunit gamma/tau (Caulobacter crescentus NA1000 Δfur)
MADHDDLSPDSAPPWDEAPAERDENTADIFGDAPAPAAEARPVVETPPEGEKGDAYTVLA
RKYRPRTFEDLIGQEAMVRTLANAFSTGRIAHAFMLTGVRGVGKTTTARLLARALNYETD
TVKGPSVDLTTEGYHCRSIIEGRHMDVLELDAASRTKVDEMRELLDGVRYAPVEARYKVY
IIDEVHMLSTAAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRCQRFDLRRVEPDVL
VKHFDRISAKEGARIEMDALALIARAAEGSVRDGLSLLDQAIVQTERGQTVTSTVVRDML
GLADRSQTIALYEHVMAGKTKDALEGFRALWGFGADPAVVMLDVLDHCHASAVSKALGPD
ALSMPKEQAARLAAIGAHTSAGTLSRLWQMLLKAHDEVRRAPDAMAAAEMALIRLCYAAD
LPGPEEALKALRDGAPVGGGGPGGGVAIGGGGAGGATASAQSPVMMAAPGAQAMPVLASF
DDVMALIAAKRDIGLRLDVEQYVRPINFRPGAITFEAAPGAPGNLAGRLVRFLKEHTGQP
WLVAAEGGGGAESLMERQKREEREALEAIKQDPFVASVLSAFPGAEIVEIRKILTPETAP
LEPDEEEG