Protein Info for CCNA_00262 in Caulobacter crescentus NA1000 Δfur

Annotation: ketopantoate reductase panE/ApbA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00745: 2-dehydropantoate 2-reductase" amino acids 4 to 288 (285 residues), 231.8 bits, see alignment E=5.6e-73 PF03807: F420_oxidored" amino acids 4 to 83 (80 residues), 23.6 bits, see alignment E=9.9e-09 PF02558: ApbA" amino acids 4 to 143 (140 residues), 103.2 bits, see alignment E=1.6e-33 PF08546: ApbA_C" amino acids 167 to 287 (121 residues), 85 bits, see alignment E=8.7e-28

Best Hits

Swiss-Prot: 100% identical to PANE_CAUVC: Putative 2-dehydropantoate 2-reductase (CC_0261) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 100% identity to ccr:CC_0261)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5I7 at UniProt or InterPro

Protein Sequence (290 amino acids)

>CCNA_00262 ketopantoate reductase panE/ApbA family protein (Caulobacter crescentus NA1000 Δfur)
MTSIAVIGPGAVGGTLAAWLAQKPDHVVTVCVRTPFEALAVETPEGAISATPRVATSPES
LAPVDWVLVTTKTYDTDATWTWLDALVGPQTRVAILRNGVEHVAPFVGKIAAERLVPAVV
DIPAERSAPGRMLQRRNGWIKVPVGPAGEAFAALFAHTPIELHVVEDFVTEAWKKLALNC
AGAVNALVLKPAGIAHDEGAAQVMRSLVRECVAVGRAEGADLSDDLPDQVIAGYRAADPG
SVNSLHADRAAGRAMELDARNGVIVRRGAAHGIATPANAMVVALLNAAAL